Anti OR14K1 pAb (ATL-HPA016643)

Atlas Antibodies

Catalog No.:
ATL-HPA016643-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: olfactory receptor, family 14, subfamily K, member 1
Gene Name: OR14K1
Alternative Gene Name: OR5AY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050613: 63%, ENSRNOG00000000749: 60%
Entrez Gene ID:
Uniprot ID: Q8NGZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DHRLHMAMYFFLRHLSFLDLCLISATVPKSILNSVASTDS
Gene Sequence DHRLHMAMYFFLRHLSFLDLCLISATVPKSILNSVASTDS
Gene ID - Mouse ENSMUSG00000050613
Gene ID - Rat ENSRNOG00000000749
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OR14K1 pAb (ATL-HPA016643)
Datasheet Anti OR14K1 pAb (ATL-HPA016643) Datasheet (External Link)
Vendor Page Anti OR14K1 pAb (ATL-HPA016643) at Atlas Antibodies

Documents & Links for Anti OR14K1 pAb (ATL-HPA016643)
Datasheet Anti OR14K1 pAb (ATL-HPA016643) Datasheet (External Link)
Vendor Page Anti OR14K1 pAb (ATL-HPA016643)