Anti OR10J3 pAb (ATL-HPA042963)

Atlas Antibodies

Catalog No.:
ATL-HPA042963-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: olfactory receptor, family 10, subfamily J, member 3
Gene Name: OR10J3
Alternative Gene Name: OR10J3P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046643: 29%, ENSRNOG00000046512: 30%
Entrez Gene ID: 441911
Uniprot ID: Q5JRS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEEQGGQRCSAQSRGAKNSVSLMKRGCEGFSFAFINMY
Gene Sequence LKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEEQGGQRCSAQSRGAKNSVSLMKRGCEGFSFAFINMY
Gene ID - Mouse ENSMUSG00000046643
Gene ID - Rat ENSRNOG00000046512
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OR10J3 pAb (ATL-HPA042963)
Datasheet Anti OR10J3 pAb (ATL-HPA042963) Datasheet (External Link)
Vendor Page Anti OR10J3 pAb (ATL-HPA042963) at Atlas Antibodies

Documents & Links for Anti OR10J3 pAb (ATL-HPA042963)
Datasheet Anti OR10J3 pAb (ATL-HPA042963) Datasheet (External Link)
Vendor Page Anti OR10J3 pAb (ATL-HPA042963)