Anti OLAH pAb (ATL-HPA037948 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037948-25

Protein Description: oleoyl-ACP hydrolase
Gene Name: OLAH
Alternative Gene Name: FLJ11106, SAST, THEDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026645: 53%, ENSRNOG00000016403: 43%
Entrez Gene ID: 55301
Uniprot ID: Q9NV23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLD
• Gene Sequence: AEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLD
• Gene ID - Mouse: ENSMUSG00000026645
• Gene ID - Rat: ENSRNOG00000016403
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OLAH pAb (ATL-HPA037948 w/enhanced validation) – 2 Found

van Herwijnen, Martijn J C; Zonneveld, Marijke I; Goerdayal, Soenita; Nolte-'t Hoen, Esther N M; Garssen, Johan; Stahl, Bernd; Maarten Altelaar, A F; Redegeld, Frank A; Wauben, Marca H M. Comprehensive Proteomic Analysis of Human Milk-derived Extracellular Vesicles Unveils a Novel Functional Proteome Distinct from Other Milk Components. Molecular & Cellular Proteomics : Mcp. 2016;15(11):3412-3423. 

de Alwis, Natasha; Beard, Sally; Binder, Natalie K; Pritchard, Natasha; Kaitu'u-Lino, Tu'uhevaha J; Walker, Susan P; Stock, Owen; Groom, Katie; Petersen, Scott; Henry, Amanda; Said, Joanne M; Seeho, Sean; Kane, Stefan C; Tong, Stephen; Hui, Lisa; Hannan, Natalie J. Placental OLAH Levels Are Altered in Fetal Growth Restriction, Preeclampsia and Models of Placental Dysfunction. Antioxidants (Basel, Switzerland). 2022;11(9)