Anti OGFOD2 pAb (ATL-HPA040306)

Atlas Antibodies

Catalog No.: ATL-HPA040306-25

Protein Description: 2-oxoglutarate and iron-dependent oxygenase domain containing 2
Gene Name: OGFOD2
Alternative Gene Name: FLJ13491, FLJ37501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023707: 87%, ENSRNOG00000001081: 87%
Entrez Gene ID: 79676
Uniprot ID: Q6N063
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARPEVYDSLQDAALAPEFLAVTEYSVSPDADLKGLLQRLETVSEEKRIYRVPVFTAPFCQALLEELEHFEQSDMPKGRPNTMNNYG
• Gene Sequence: ARPEVYDSLQDAALAPEFLAVTEYSVSPDADLKGLLQRLETVSEEKRIYRVPVFTAPFCQALLEELEHFEQSDMPKGRPNTMNNYG
• Gene ID - Mouse: ENSMUSG00000023707
• Gene ID - Rat: ENSRNOG00000001081
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.