Anti OGDH pAb (ATL-HPA020347)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020347-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: OGDH
Alternative Gene Name: E1k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020456: 94%, ENSRNOG00000005130: 94%
Entrez Gene ID: 4967
Uniprot ID: Q02218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQ |
| Gene Sequence | FRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQ |
| Gene ID - Mouse | ENSMUSG00000020456 |
| Gene ID - Rat | ENSRNOG00000005130 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OGDH pAb (ATL-HPA020347) | |
| Datasheet | Anti OGDH pAb (ATL-HPA020347) Datasheet (External Link) |
| Vendor Page | Anti OGDH pAb (ATL-HPA020347) at Atlas Antibodies |
| Documents & Links for Anti OGDH pAb (ATL-HPA020347) | |
| Datasheet | Anti OGDH pAb (ATL-HPA020347) Datasheet (External Link) |
| Vendor Page | Anti OGDH pAb (ATL-HPA020347) |
| Citations for Anti OGDH pAb (ATL-HPA020347) – 5 Found |
| Ilic, Nina; Birsoy, Kıvanç; Aguirre, Andrew J; Kory, Nora; Pacold, Michael E; Singh, Shambhavi; Moody, Susan E; DeAngelo, Joseph D; Spardy, Nicole A; Freinkman, Elizaveta; Weir, Barbara A; Tsherniak, Aviad; Cowley, Glenn S; Root, David E; Asara, John M; Vazquez, Francisca; Widlund, Hans R; Sabatini, David M; Hahn, William C. PIK3CA mutant tumors depend on oxoglutarate dehydrogenase. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(17):E3434-E3443. PubMed |
| Ast, Tslil; Meisel, Joshua D; Patra, Shachin; Wang, Hong; Grange, Robert M H; Kim, Sharon H; Calvo, Sarah E; Orefice, Lauren L; Nagashima, Fumiaki; Ichinose, Fumito; Zapol, Warren M; Ruvkun, Gary; Barondeau, David P; Mootha, Vamsi K. Hypoxia Rescues Frataxin Loss by Restoring Iron Sulfur Cluster Biogenesis. Cell. 2019;177(6):1507-1521.e16. PubMed |
| Dobolyi, Arpad; Bago, Attila; Palkovits, Miklos; Nemeria, Natalia S; Jordan, Frank; Doczi, Judit; Ambrus, Attila; Adam-Vizi, Vera; Chinopoulos, Christos. Exclusive neuronal detection of KGDHC-specific subunits in the adult human brain cortex despite pancellular protein lysine succinylation. Brain Structure & Function. 2020;225(2):639-667. PubMed |
| Kafkia, Eleni; Andres-Pons, Amparo; Ganter, Kerstin; Seiler, Markus; Smith, Tom S; Andrejeva, Anna; Jouhten, Paula; Pereira, Filipa; Franco, Catarina; Kuroshchenkova, Anna; Leone, Sergio; Sawarkar, Ritwick; Boston, Rebecca; Thaventhiran, James; Zaugg, Judith B; Lilley, Kathryn S; Lancrin, Christophe; Beck, Martin; Patil, Kiran Raosaheb. Operation of a TCA cycle subnetwork in the mammalian nucleus. Science Advances. 2022;8(35):eabq5206. PubMed |
| Forny, Patrick; Bonilla, Ximena; Lamparter, David; Shao, Wenguang; Plessl, Tanja; Frei, Caroline; Bingisser, Anna; Goetze, Sandra; van Drogen, Audrey; Harshman, Keith; Pedrioli, Patrick G A; Howald, Cedric; Poms, Martin; Traversi, Florian; Bürer, Céline; Cherkaoui, Sarah; Morscher, Raphael J; Simmons, Luke; Forny, Merima; Xenarios, Ioannis; Aebersold, Ruedi; Zamboni, Nicola; Rätsch, Gunnar; Dermitzakis, Emmanouil T; Wollscheid, Bernd; Baumgartner, Matthias R; Froese, D Sean. Integrated multi-omics reveals anaplerotic rewiring in methylmalonyl-CoA mutase deficiency. Nature Metabolism. 2023;5(1):80-95. PubMed |