Anti OGDH pAb (ATL-HPA019514)

Atlas Antibodies

Catalog No.: ATL-HPA019514-25

Protein Description: oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide)
Gene Name: OGDH
Alternative Gene Name: E1k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020456: 97%, ENSRNOG00000005130: 97%
Entrez Gene ID: 4967
Uniprot ID: Q02218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSV
• Gene Sequence: LRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSV
• Gene ID - Mouse: ENSMUSG00000020456
• Gene ID - Rat: ENSRNOG00000005130
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OGDH pAb (ATL-HPA019514) – 2 Found

Choi, Sujung; Pfleger, Jessica; Jeon, Yong Heui; Yang, Zhi; He, Minzhen; Shin, Hyewon; Sayed, Danish; Astrof, Sophie; Abdellatif, Maha. Oxoglutarate dehydrogenase and acetyl-CoA acyltransferase 2 selectively associate with H2A.Z-occupied promoters and are required for histone modifications. Biochimica Et Biophysica Acta. Gene Regulatory Mechanisms. 2019;1862(10):194436. 

Dobolyi, Arpad; Bago, Attila; Palkovits, Miklos; Nemeria, Natalia S; Jordan, Frank; Doczi, Judit; Ambrus, Attila; Adam-Vizi, Vera; Chinopoulos, Christos. Exclusive neuronal detection of KGDHC-specific subunits in the adult human brain cortex despite pancellular protein lysine succinylation. Brain Structure & Function. 2020;225(2):639-667.