Anti OCRL pAb (ATL-HPA012495 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012495-25

Protein Description: oculocerebrorenal syndrome of Lowe
Gene Name: OCRL
Alternative Gene Name: OCRL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001173: 97%, ENSRNOG00000003875: 99%
Entrez Gene ID: 4952
Uniprot ID: Q01968
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELY
• Gene Sequence: DYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELY
• Gene ID - Mouse: ENSMUSG00000001173
• Gene ID - Rat: ENSRNOG00000003875
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OCRL pAb (ATL-HPA012495 w/enhanced validation) – 3 Found

He, Kangmin; Marsland, Robert III; Upadhyayula, Srigokul; Song, Eli; Dang, Song; Capraro, Benjamin R; Wang, Weiming; Skillern, Wesley; Gaudin, Raphael; Ma, Minghe; Kirchhausen, Tom. Dynamics of phosphoinositide conversion in clathrin-mediated endocytic traffic. Nature. 2017;552(7685):410-414. 

Bohdanowicz, Michal; Balkin, Daniel M; De Camilli, Pietro; Grinstein, Sergio. Recruitment of OCRL and Inpp5B to phagosomes by Rab5 and APPL1 depletes phosphoinositides and attenuates Akt signaling. Molecular Biology Of The Cell. 2012;23(1):176-87. 

Naik, Sindhu; Wood, Andrew R; Ongenaert, Maté; Saidiyan, Paniz; Elstak, Edo D; Lanz, Henriëtte L; Stallen, Jan; Janssen, Richard; Smythe, Elizabeth; Erdmann, Kai S. A 3D Renal Proximal Tubule on Chip Model Phenocopies Lowe Syndrome and Dent II Disease Tubulopathy. International Journal Of Molecular Sciences. 2021;22(10)