Anti OCIAD2 pAb (ATL-HPA041090 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041090-25

Protein Description: OCIA domain containing 2
Gene Name: OCIAD2
Alternative Gene Name: MGC45416
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029153: 79%, ENSRNOG00000002196: 79%
Entrez Gene ID: 132299
Uniprot ID: Q56VL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRA
• Gene Sequence: ASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRA
• Gene ID - Mouse: ENSMUSG00000029153
• Gene ID - Rat: ENSRNOG00000002196
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OCIAD2 pAb (ATL-HPA041090 w/enhanced validation) – 1 Found

Sinha, Saloni; Bheemsetty, Venkata Anudeep; Inamdar, Maneesha S. A double helical motif in OCIAD2 is essential for its localization, interactions and STAT3 activation. Scientific Reports. 2018;8(1):7362.