Anti OBSL1 pAb (ATL-HPA036405)

Atlas Antibodies

Catalog No.:
ATL-HPA036405-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: obscurin-like 1
Gene Name: OBSL1
Alternative Gene Name: KIAA0657
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026211: 93%, ENSRNOG00000015346: 35%
Entrez Gene ID: 23363
Uniprot ID: O75147
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVE
Gene Sequence VRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVE
Gene ID - Mouse ENSMUSG00000026211
Gene ID - Rat ENSRNOG00000015346
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OBSL1 pAb (ATL-HPA036405)
Datasheet Anti OBSL1 pAb (ATL-HPA036405) Datasheet (External Link)
Vendor Page Anti OBSL1 pAb (ATL-HPA036405) at Atlas Antibodies

Documents & Links for Anti OBSL1 pAb (ATL-HPA036405)
Datasheet Anti OBSL1 pAb (ATL-HPA036405) Datasheet (External Link)
Vendor Page Anti OBSL1 pAb (ATL-HPA036405)