Anti OBSL1 pAb (ATL-HPA036404)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036404-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: OBSL1
Alternative Gene Name: KIAA0657
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026211: 86%, ENSRNOG00000015346: 91%
Entrez Gene ID: 23363
Uniprot ID: O75147
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP |
| Gene Sequence | NAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP |
| Gene ID - Mouse | ENSMUSG00000026211 |
| Gene ID - Rat | ENSRNOG00000015346 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OBSL1 pAb (ATL-HPA036404) | |
| Datasheet | Anti OBSL1 pAb (ATL-HPA036404) Datasheet (External Link) |
| Vendor Page | Anti OBSL1 pAb (ATL-HPA036404) at Atlas Antibodies |
| Documents & Links for Anti OBSL1 pAb (ATL-HPA036404) | |
| Datasheet | Anti OBSL1 pAb (ATL-HPA036404) Datasheet (External Link) |
| Vendor Page | Anti OBSL1 pAb (ATL-HPA036404) |
| Citations for Anti OBSL1 pAb (ATL-HPA036404) – 1 Found |
| Wüstenhagen, Elena; Hampe, Laura; Boukhallouk, Fatima; Schneider, Marc A; Spoden, Gilles A; Negwer, Inka; Koynov, Kaloian; Kast, W Martin; Florin, Luise. The Cytoskeletal Adaptor Obscurin-Like 1 Interacts with the Human Papillomavirus 16 (HPV16) Capsid Protein L2 and Is Required for HPV16 Endocytosis. Journal Of Virology. 2016;90(23):10629-10641. PubMed |