Anti NUTF2 pAb (ATL-HPA040915)

Atlas Antibodies

Catalog No.:
ATL-HPA040915-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nuclear transport factor 2
Gene Name: NUTF2
Alternative Gene Name: NTF2, PP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008450: 100%, ENSRNOG00000018945: 100%
Entrez Gene ID: 10204
Uniprot ID: P61970
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Gene Sequence KIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Gene ID - Mouse ENSMUSG00000008450
Gene ID - Rat ENSRNOG00000018945
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUTF2 pAb (ATL-HPA040915)
Datasheet Anti NUTF2 pAb (ATL-HPA040915) Datasheet (External Link)
Vendor Page Anti NUTF2 pAb (ATL-HPA040915) at Atlas Antibodies

Documents & Links for Anti NUTF2 pAb (ATL-HPA040915)
Datasheet Anti NUTF2 pAb (ATL-HPA040915) Datasheet (External Link)
Vendor Page Anti NUTF2 pAb (ATL-HPA040915)