Anti NUP54 pAb (ATL-HPA035929)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035929-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: NUP54
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034826: 99%, ENSRNOG00000002247: 100%
Entrez Gene ID: 53371
Uniprot ID: Q7Z3B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTR |
| Gene Sequence | PATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTR |
| Gene ID - Mouse | ENSMUSG00000034826 |
| Gene ID - Rat | ENSRNOG00000002247 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NUP54 pAb (ATL-HPA035929) | |
| Datasheet | Anti NUP54 pAb (ATL-HPA035929) Datasheet (External Link) |
| Vendor Page | Anti NUP54 pAb (ATL-HPA035929) at Atlas Antibodies |
| Documents & Links for Anti NUP54 pAb (ATL-HPA035929) | |
| Datasheet | Anti NUP54 pAb (ATL-HPA035929) Datasheet (External Link) |
| Vendor Page | Anti NUP54 pAb (ATL-HPA035929) |