Anti NUP54 pAb (ATL-HPA035929)

Atlas Antibodies

Catalog No.:
ATL-HPA035929-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: nucleoporin 54kDa
Gene Name: NUP54
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034826: 99%, ENSRNOG00000002247: 100%
Entrez Gene ID: 53371
Uniprot ID: Q7Z3B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen PATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTR
Gene Sequence PATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTR
Gene ID - Mouse ENSMUSG00000034826
Gene ID - Rat ENSRNOG00000002247
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUP54 pAb (ATL-HPA035929)
Datasheet Anti NUP54 pAb (ATL-HPA035929) Datasheet (External Link)
Vendor Page Anti NUP54 pAb (ATL-HPA035929) at Atlas Antibodies

Documents & Links for Anti NUP54 pAb (ATL-HPA035929)
Datasheet Anti NUP54 pAb (ATL-HPA035929) Datasheet (External Link)
Vendor Page Anti NUP54 pAb (ATL-HPA035929)