Anti NUDT16L1 pAb (ATL-HPA044186)

Atlas Antibodies

Catalog No.:
ATL-HPA044186-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1
Gene Name: NUDT16L1
Alternative Gene Name: SDOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022516: 96%, ENSRNOG00000003224: 96%
Entrez Gene ID: 84309
Uniprot ID: Q9BRJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVL
Gene Sequence AVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVL
Gene ID - Mouse ENSMUSG00000022516
Gene ID - Rat ENSRNOG00000003224
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUDT16L1 pAb (ATL-HPA044186)
Datasheet Anti NUDT16L1 pAb (ATL-HPA044186) Datasheet (External Link)
Vendor Page Anti NUDT16L1 pAb (ATL-HPA044186) at Atlas Antibodies

Documents & Links for Anti NUDT16L1 pAb (ATL-HPA044186)
Datasheet Anti NUDT16L1 pAb (ATL-HPA044186) Datasheet (External Link)
Vendor Page Anti NUDT16L1 pAb (ATL-HPA044186)
Citations for Anti NUDT16L1 pAb (ATL-HPA044186) – 2 Found
Avolio, Rosario; Järvelin, Aino I; Mohammed, Shabaz; Agliarulo, Ilenia; Condelli, Valentina; Zoppoli, Pietro; Calice, Giovanni; Sarnataro, Daniela; Bechara, Elias; Tartaglia, Gian G; Landriscina, Matteo; Castello, Alfredo; Esposito, Franca; Matassa, Danilo S. Protein Syndesmos is a novel RNA-binding protein that regulates primary cilia formation. Nucleic Acids Research. 2018;46(22):12067-12086.  PubMed
Ketley, Ruth F; Battistini, Federica; Alagia, Adele; Mondielli, Clémence; Iehl, Florence; Balikçi, Esra; Huber, Kilian V M; Orozco, Modesto; Gullerova, Monika. DNA double-strand break-derived RNA drives TIRR/53BP1 complex dissociation. Cell Reports. 2022;41(4):111526.  PubMed