Anti NUDCD2 pAb (ATL-HPA037384)

Atlas Antibodies

Catalog No.: ATL-HPA037384-100

Protein Description: NudC domain containing 2
Gene Name: NUDCD2
Alternative Gene Name: DKFZp686E10109
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020328: 100%, ENSRNOG00000060914: 100%
Entrez Gene ID: 134492
Uniprot ID: Q8WVJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDF
• Gene Sequence: LFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDF
• Gene ID - Mouse: ENSMUSG00000020328
• Gene ID - Rat: ENSRNOG00000060914
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.