Anti NUBP2 pAb (ATL-HPA041704)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041704-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NUBP2
Alternative Gene Name: CFD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039183: 88%, ENSRNOG00000015090: 88%
Entrez Gene ID: 10101
Uniprot ID: Q9Y5Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRGWAPVF |
| Gene Sequence | STISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRGWAPVF |
| Gene ID - Mouse | ENSMUSG00000039183 |
| Gene ID - Rat | ENSRNOG00000015090 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NUBP2 pAb (ATL-HPA041704) | |
| Datasheet | Anti NUBP2 pAb (ATL-HPA041704) Datasheet (External Link) |
| Vendor Page | Anti NUBP2 pAb (ATL-HPA041704) at Atlas Antibodies |
| Documents & Links for Anti NUBP2 pAb (ATL-HPA041704) | |
| Datasheet | Anti NUBP2 pAb (ATL-HPA041704) Datasheet (External Link) |
| Vendor Page | Anti NUBP2 pAb (ATL-HPA041704) |