Anti NUBP2 pAb (ATL-HPA041704)

Atlas Antibodies

Catalog No.:
ATL-HPA041704-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nucleotide binding protein 2
Gene Name: NUBP2
Alternative Gene Name: CFD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039183: 88%, ENSRNOG00000015090: 88%
Entrez Gene ID: 10101
Uniprot ID: Q9Y5Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRGWAPVF
Gene Sequence STISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRGWAPVF
Gene ID - Mouse ENSMUSG00000039183
Gene ID - Rat ENSRNOG00000015090
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUBP2 pAb (ATL-HPA041704)
Datasheet Anti NUBP2 pAb (ATL-HPA041704) Datasheet (External Link)
Vendor Page Anti NUBP2 pAb (ATL-HPA041704) at Atlas Antibodies

Documents & Links for Anti NUBP2 pAb (ATL-HPA041704)
Datasheet Anti NUBP2 pAb (ATL-HPA041704) Datasheet (External Link)
Vendor Page Anti NUBP2 pAb (ATL-HPA041704)