Anti NT5DC1 pAb (ATL-HPA030352)

Atlas Antibodies

Catalog No.: ATL-HPA030352-100

Protein Description: 5'-nucleotidase domain containing 1
Gene Name: NT5DC1
Alternative Gene Name: dJ486I3.1, MGC24302, NT5C2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039480: 88%, ENSRNOG00000000546: 87%
Entrez Gene ID: 221294
Uniprot ID: Q5TFE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFFSHLPSQRPFRTLENDEEQEALPSLDKPGWYSQGNAVHLYELLKKMTGKPEPKVVYFGDSMHSDIFPARHYSNWETVLILEELR
• Gene Sequence: GFFSHLPSQRPFRTLENDEEQEALPSLDKPGWYSQGNAVHLYELLKKMTGKPEPKVVYFGDSMHSDIFPARHYSNWETVLILEELR
• Gene ID - Mouse: ENSMUSG00000039480
• Gene ID - Rat: ENSRNOG00000000546
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.