Anti NSUN3 pAb (ATL-HPA036181)

Atlas Antibodies

Catalog No.: ATL-HPA036181-25

Protein Description: NOP2/Sun domain family, member 3
Gene Name: NSUN3
Alternative Gene Name: FLJ22609
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050312: 87%, ENSRNOG00000054275: 86%
Entrez Gene ID: 63899
Uniprot ID: Q9H649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSELDGRKMGDAQPEMFDKVLVDAPCSNDRSWLFSSDSQKASCRISQR
• Gene Sequence: PGGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSELDGRKMGDAQPEMFDKVLVDAPCSNDRSWLFSSDSQKASCRISQR
• Gene ID - Mouse: ENSMUSG00000050312
• Gene ID - Rat: ENSRNOG00000054275
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NSUN3 pAb (ATL-HPA036181) – 1 Found

Van Haute, Lindsey; Dietmann, Sabine; Kremer, Laura; Hussain, Shobbir; Pearce, Sarah F; Powell, Christopher A; Rorbach, Joanna; Lantaff, Rebecca; Blanco, Sandra; Sauer, Sascha; Kotzaeridou, Urania; Hoffmann, Georg F; Memari, Yasin; Kolb-Kokocinski, Anja; Durbin, Richard; Mayr, Johannes A; Frye, Michaela; Prokisch, Holger; Minczuk, Michal. Deficient methylation and formylation of mt-tRNA(Met) wobble cytosine in a patient carrying mutations in NSUN3. Nature Communications. 2016;7( 27356879):12039.