Anti NSMF pAb (ATL-HPA044316 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044316-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NMDA receptor synaptonuclear signaling and neuronal migration factor
Gene Name: NSMF
Alternative Gene Name: NELF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006476: 98%, ENSRNOG00000008810: 98%
Entrez Gene ID: 26012
Uniprot ID: Q6X4W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL
Gene Sequence KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL
Gene ID - Mouse ENSMUSG00000006476
Gene ID - Rat ENSRNOG00000008810
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NSMF pAb (ATL-HPA044316 w/enhanced validation)
Datasheet Anti NSMF pAb (ATL-HPA044316 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NSMF pAb (ATL-HPA044316 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NSMF pAb (ATL-HPA044316 w/enhanced validation)
Datasheet Anti NSMF pAb (ATL-HPA044316 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NSMF pAb (ATL-HPA044316 w/enhanced validation)