Anti NSMCE1 pAb (ATL-HPA043091)

Atlas Antibodies

Catalog No.:
ATL-HPA043091-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: non-SMC element 1 homolog (S. cerevisiae)
Gene Name: NSMCE1
Alternative Gene Name: NSE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030750: 79%, ENSRNOG00000015218: 87%
Entrez Gene ID: 197370
Uniprot ID: Q8WV22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNK
Gene Sequence EQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNK
Gene ID - Mouse ENSMUSG00000030750
Gene ID - Rat ENSRNOG00000015218
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NSMCE1 pAb (ATL-HPA043091)
Datasheet Anti NSMCE1 pAb (ATL-HPA043091) Datasheet (External Link)
Vendor Page Anti NSMCE1 pAb (ATL-HPA043091) at Atlas Antibodies

Documents & Links for Anti NSMCE1 pAb (ATL-HPA043091)
Datasheet Anti NSMCE1 pAb (ATL-HPA043091) Datasheet (External Link)
Vendor Page Anti NSMCE1 pAb (ATL-HPA043091)