Anti NSD2 pAb (ATL-HPA015801 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015801-25

Protein Description: nuclear receptor binding SET domain protein 2
Gene Name: NSD2
Alternative Gene Name: KMT3G, MMSET, WHSC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057406: 91%, ENSRNOG00000038140: 91%
Entrez Gene ID: 7468
Uniprot ID: O96028
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGD
• Gene Sequence: SANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGD
• Gene ID - Mouse: ENSMUSG00000057406
• Gene ID - Rat: ENSRNOG00000038140
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NSD2 pAb (ATL-HPA015801 w/enhanced validation) – 4 Found

Dong, Peixin; Xiong, Ying; Yue, Junming; Hanley, Sharon J B; Watari, Hidemichi. miR-34a, miR-424 and miR-513 inhibit MMSET expression to repress endometrial cancer cell invasion and sphere formation. Oncotarget. 2018;9(33):23253-23263. 

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Toyokawa, Gouji; Cho, Hyun-Soo; Masuda, Ken; Yamane, Yuka; Yoshimatsu, Masanori; Hayami, Shinya; Takawa, Masashi; Iwai, Yukiko; Daigo, Yataro; Tsuchiya, Eiju; Tsunoda, Tatsuhiko; Field, Helen I; Kelly, John D; Neal, David E; Maehara, Yoshihiko; Ponder, Bruce Aj; Nakamura, Yusuke; Hamamoto, Ryuji. Histone lysine methyltransferase Wolf-Hirschhorn syndrome candidate 1 is involved in human carcinogenesis through regulation of the Wnt pathway. Neoplasia (New York, N.y.). 2011;13(10):887-98. 

Dilg, Daniel; Saleh, Rasha Noureldin M; Phelps, Sarah Elizabeth Lee; Rose, Yoann; Dupays, Laurent; Murphy, Cian; Mohun, Timothy; Anderson, Robert H; Scambler, Peter J; Chapgier, Ariane L A. HIRA Is Required for Heart Development and Directly Regulates Tnni2 and Tnnt3. Plos One. 11(8):e0161096.