Anti NSA2 pAb (ATL-HPA043487)

Atlas Antibodies

Catalog No.:
ATL-HPA043487-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NSA2 ribosome biogenesis homolog (S. cerevisiae)
Gene Name: NSA2
Alternative Gene Name: FLJ94393, HCLG1, HUSSY-29, TINP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060739: 100%, ENSRNOG00000016530: 100%
Entrez Gene ID: 10412
Uniprot ID: O95478
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRF
Gene Sequence VLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRF
Gene ID - Mouse ENSMUSG00000060739
Gene ID - Rat ENSRNOG00000016530
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NSA2 pAb (ATL-HPA043487)
Datasheet Anti NSA2 pAb (ATL-HPA043487) Datasheet (External Link)
Vendor Page Anti NSA2 pAb (ATL-HPA043487) at Atlas Antibodies

Documents & Links for Anti NSA2 pAb (ATL-HPA043487)
Datasheet Anti NSA2 pAb (ATL-HPA043487) Datasheet (External Link)
Vendor Page Anti NSA2 pAb (ATL-HPA043487)