Anti NRAP pAb (ATL-HPA037953 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037953-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nebulin-related anchoring protein
Gene Name: NRAP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049134: 69%, ENSRNOG00000016714: 69%
Entrez Gene ID: 4892
Uniprot ID: Q86VF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFTSVYHTPLNLNVRTFPEAISGIHDQEDGEQCKSVFHWDMKSKDKEGAPNRQPLANERAYWTGYGEGNAWCPGALPDPEIVRMVE
Gene Sequence TFTSVYHTPLNLNVRTFPEAISGIHDQEDGEQCKSVFHWDMKSKDKEGAPNRQPLANERAYWTGYGEGNAWCPGALPDPEIVRMVE
Gene ID - Mouse ENSMUSG00000049134
Gene ID - Rat ENSRNOG00000016714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NRAP pAb (ATL-HPA037953 w/enhanced validation)
Datasheet Anti NRAP pAb (ATL-HPA037953 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NRAP pAb (ATL-HPA037953 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NRAP pAb (ATL-HPA037953 w/enhanced validation)
Datasheet Anti NRAP pAb (ATL-HPA037953 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NRAP pAb (ATL-HPA037953 w/enhanced validation)