Anti NR4A3 pAb (ATL-HPA043360)

Atlas Antibodies

Catalog No.: ATL-HPA043360-25

Protein Description: nuclear receptor subfamily 4, group A, member 3
Gene Name: NR4A3
Alternative Gene Name: CHN, CSMF, MINOR, NOR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028341: 97%, ENSRNOG00000005964: 97%
Entrez Gene ID: 8013
Uniprot ID: Q92570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKI
• Gene Sequence: KPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKI
• Gene ID - Mouse: ENSMUSG00000028341
• Gene ID - Rat: ENSRNOG00000005964
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NR4A3 pAb (ATL-HPA043360) – 1 Found

Takahashi, Hiroyuki; Nomiyama, Takashi; Terawaki, Yuichi; Kawanami, Takako; Hamaguchi, Yuriko; Tanaka, Tomoko; Tanabe, Makito; Bruemmer, Dennis; Yanase, Toshihiko. GLP-1 Receptor Agonist Exendin-4 Attenuates NR4A Orphan Nuclear Receptor NOR1 Expression in Vascular Smooth Muscle Cells. Journal Of Atherosclerosis And Thrombosis. 2019;26(2):183-197.