Anti NR2C2AP pAb (ATL-HPA042054 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042054-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nuclear receptor 2C2-associated protein
Gene Name: NR2C2AP
Alternative Gene Name: TRA16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071078: 80%, ENSRNOG00000002320: 28%
Entrez Gene ID: 126382
Uniprot ID: Q86WQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV
Gene Sequence GSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV
Gene ID - Mouse ENSMUSG00000071078
Gene ID - Rat ENSRNOG00000002320
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NR2C2AP pAb (ATL-HPA042054 w/enhanced validation)
Datasheet Anti NR2C2AP pAb (ATL-HPA042054 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NR2C2AP pAb (ATL-HPA042054 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NR2C2AP pAb (ATL-HPA042054 w/enhanced validation)
Datasheet Anti NR2C2AP pAb (ATL-HPA042054 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NR2C2AP pAb (ATL-HPA042054 w/enhanced validation)