Anti NR2C2AP pAb (ATL-HPA042054 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042054-25

Protein Description: nuclear receptor 2C2-associated protein
Gene Name: NR2C2AP
Alternative Gene Name: TRA16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071078: 80%, ENSRNOG00000002320: 28%
Entrez Gene ID: 126382
Uniprot ID: Q86WQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV
• Gene Sequence: GSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV
• Gene ID - Mouse: ENSMUSG00000071078
• Gene ID - Rat: ENSRNOG00000002320
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.