Anti NR1I2 pAb (ATL-HPA029309)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029309-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NR1I2
Alternative Gene Name: BXR, ONR1, PAR2, PXR, SXR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022809: 75%, ENSRNOG00000002906: 72%
Entrez Gene ID: 8856
Uniprot ID: O75469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLK |
| Gene Sequence | VQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLK |
| Gene ID - Mouse | ENSMUSG00000022809 |
| Gene ID - Rat | ENSRNOG00000002906 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NR1I2 pAb (ATL-HPA029309) | |
| Datasheet | Anti NR1I2 pAb (ATL-HPA029309) Datasheet (External Link) |
| Vendor Page | Anti NR1I2 pAb (ATL-HPA029309) at Atlas Antibodies |
| Documents & Links for Anti NR1I2 pAb (ATL-HPA029309) | |
| Datasheet | Anti NR1I2 pAb (ATL-HPA029309) Datasheet (External Link) |
| Vendor Page | Anti NR1I2 pAb (ATL-HPA029309) |