Anti NPVF pAb (ATL-HPA041733)

Atlas Antibodies

Catalog No.:
ATL-HPA041733-25
Immunohistochemical staining of human eye, retina shows strong positivity.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: neuropeptide VF precursor
Gene Name: NPVF
Alternative Gene Name: C7orf9, RFRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029831: 44%, ENSRNOG00000010806: 48%
Entrez Gene ID: 64111
Uniprot ID: Q9HCQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQ
Gene Sequence TANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQ
Gene ID - Mouse ENSMUSG00000029831
Gene ID - Rat ENSRNOG00000010806
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NPVF pAb (ATL-HPA041733)
Datasheet Anti NPVF pAb (ATL-HPA041733) Datasheet (External Link)
Vendor Page Anti NPVF pAb (ATL-HPA041733) at Atlas Antibodies

Documents & Links for Anti NPVF pAb (ATL-HPA041733)
Datasheet Anti NPVF pAb (ATL-HPA041733) Datasheet (External Link)
Vendor Page Anti NPVF pAb (ATL-HPA041733)
Citations for Anti NPVF pAb (ATL-HPA041733) – 1 Found
Lovett-Barron, Matthew; Andalman, Aaron S; Allen, William E; Vesuna, Sam; Kauvar, Isaac; Burns, Vanessa M; Deisseroth, Karl. Ancestral Circuits for the Coordinated Modulation of Brain State. Cell. 2017;171(6):1411-1423.e17.  PubMed
!