Anti NPRL2 pAb (ATL-HPA038196)

Atlas Antibodies

Catalog No.: ATL-HPA038196-25

Protein Description: nitrogen permease regulator-like 2 (S. cerevisiae)
Gene Name: NPRL2
Alternative Gene Name: NPR2, NPR2L, TUSC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010057: 97%, ENSRNOG00000021660: 97%
Entrez Gene ID: 10641
Uniprot ID: Q8WTW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHSYDEICCKTGMSYHELDERLENDPNIIICW
• Gene Sequence: KLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHSYDEICCKTGMSYHELDERLENDPNIIICW
• Gene ID - Mouse: ENSMUSG00000010057
• Gene ID - Rat: ENSRNOG00000021660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NPRL2 pAb (ATL-HPA038196) – 1 Found

Wang, Ya-Chin; Tsai, Ming-Chao; Chen, Yaw-Sen; Hsieh, Pei-Min; Hung, Chao-Ming; Lin, Hung-Yu; Hsu, Yao-Chun; Yeh, Jen-Hao; Hsiao, Pojen; Su, Yu-Cheih; Ma, Ching-Hou; Lee, Chih-Yuan; Lin, Chih-Che; Shu, Chih-Wen; Li, Yu-Chan; Tsai, Mei-Hsing; Lin, James Yu; Peng, Wei-Hao; Yu, Ming-Lung; Lin, Chih-Wen. NPRL2 down-regulation facilitates the growth of hepatocellular carcinoma via the mTOR pathway and autophagy suppression. Hepatology Communications. 2022;6(12):3563-3577.