Anti NPM3 pAb (ATL-HPA036295)

Atlas Antibodies

Catalog No.:
ATL-HPA036295-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nucleophosmin/nucleoplasmin 3
Gene Name: NPM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056209: 94%, ENSRNOG00000017622: 94%
Entrez Gene ID: 10360
Uniprot ID: O75607
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVV
Gene Sequence APVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVV
Gene ID - Mouse ENSMUSG00000056209
Gene ID - Rat ENSRNOG00000017622
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NPM3 pAb (ATL-HPA036295)
Datasheet Anti NPM3 pAb (ATL-HPA036295) Datasheet (External Link)
Vendor Page Anti NPM3 pAb (ATL-HPA036295) at Atlas Antibodies

Documents & Links for Anti NPM3 pAb (ATL-HPA036295)
Datasheet Anti NPM3 pAb (ATL-HPA036295) Datasheet (External Link)
Vendor Page Anti NPM3 pAb (ATL-HPA036295)