Anti NPEPPS pAb (ATL-HPA021453)

Atlas Antibodies

Catalog No.: ATL-HPA021453-25

Protein Description: aminopeptidase puromycin sensitive
Gene Name: NPEPPS
Alternative Gene Name: MP100, PSA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001441: 95%, ENSRNOG00000023095: 96%
Entrez Gene ID: 9520
Uniprot ID: P55786
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKVLTFALSE
• Gene Sequence: TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKVLTFALSE
• Gene ID - Mouse: ENSMUSG00000001441
• Gene ID - Rat: ENSRNOG00000023095
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.