Anti NOSTRIN pAb (ATL-HPA044384)

Atlas Antibodies

Catalog No.: ATL-HPA044384-25

Protein Description: nitric oxide synthase trafficking
Gene Name: NOSTRIN
Alternative Gene Name: MGC20702
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034738: 89%, ENSRNOG00000006611: 86%
Entrez Gene ID: 115677
Uniprot ID: Q8IVI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKSLLKPKLLRL
• Gene Sequence: TLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKSLLKPKLLRL
• Gene ID - Mouse: ENSMUSG00000034738
• Gene ID - Rat: ENSRNOG00000006611
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.