Anti NME5 pAb (ATL-HPA044555)

Atlas Antibodies

Catalog No.: ATL-HPA044555-25

Protein Description: NME/NM23 family member 5
Gene Name: NME5
Alternative Gene Name: nm23-H5, RSPH23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035984: 79%, ENSRNOG00000020118: 85%
Entrez Gene ID: 8382
Uniprot ID: P56597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
• Gene Sequence: FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
• Gene ID - Mouse: ENSMUSG00000035984
• Gene ID - Rat: ENSRNOG00000020118
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NME5 pAb (ATL-HPA044555) – 3 Found

Frommer, Adrien; Hjeij, Rim; Loges, Niki T; Edelbusch, Christine; Jahnke, Charlotte; Raidt, Johanna; Werner, Claudius; Wallmeier, Julia; Große-Onnebrink, Jörg; Olbrich, Heike; Cindrić, Sandra; Jaspers, Martine; Boon, Mieke; Memari, Yasin; Durbin, Richard; Kolb-Kokocinski, Anja; Sauer, Sascha; Marthin, June K; Nielsen, Kim G; Amirav, Israel; Elias, Nael; Kerem, Eitan; Shoseyov, David; Haeffner, Karsten; Omran, Heymut. Immunofluorescence Analysis and Diagnosis of Primary Ciliary Dyskinesia with Radial Spoke Defects. American Journal Of Respiratory Cell And Molecular Biology. 2015;53(4):563-73. 

Jeanson, Ludovic; Copin, Bruno; Papon, Jean-François; Dastot-Le Moal, Florence; Duquesnoy, Philippe; Montantin, Guy; Cadranel, Jacques; Corvol, Harriet; Coste, André; Désir, Julie; Souayah, Anissa; Kott, Esther; Collot, Nathalie; Tissier, Sylvie; Louis, Bruno; Tamalet, Aline; de Blic, Jacques; Clement, Annick; Escudier, Estelle; Amselem, Serge; Legendre, Marie. RSPH3 Mutations Cause Primary Ciliary Dyskinesia with Central-Complex Defects and a Near Absence of Radial Spokes. American Journal Of Human Genetics. 2015;97(1):153-62. 

Yoke, Hiroshi; Ueno, Hironori; Narita, Akihiro; Sakai, Takafumi; Horiuchi, Kahoru; Shingyoji, Chikako; Hamada, Hiroshi; Shinohara, Kyosuke. Rsph4a is essential for the triplet radial spoke head assembly of the mouse motile cilia. Plos Genetics. 2020;16(3):e1008664.