Anti NLE1 pAb (ATL-HPA018807)

Atlas Antibodies

Catalog No.: ATL-HPA018807-25

Protein Description: notchless homolog 1 (Drosophila)
Gene Name: NLE1
Alternative Gene Name: FLJ10458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020692: 95%, ENSRNOG00000008287: 95%
Entrez Gene ID: 54475
Uniprot ID: Q9NVX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTL
• Gene Sequence: TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTL
• Gene ID - Mouse: ENSMUSG00000020692
• Gene ID - Rat: ENSRNOG00000008287
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.