Anti NLE1 pAb (ATL-HPA018807)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018807-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NLE1
Alternative Gene Name: FLJ10458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020692: 95%, ENSRNOG00000008287: 95%
Entrez Gene ID: 54475
Uniprot ID: Q9NVX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTL |
| Gene Sequence | TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTL |
| Gene ID - Mouse | ENSMUSG00000020692 |
| Gene ID - Rat | ENSRNOG00000008287 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NLE1 pAb (ATL-HPA018807) | |
| Datasheet | Anti NLE1 pAb (ATL-HPA018807) Datasheet (External Link) |
| Vendor Page | Anti NLE1 pAb (ATL-HPA018807) at Atlas Antibodies |
| Documents & Links for Anti NLE1 pAb (ATL-HPA018807) | |
| Datasheet | Anti NLE1 pAb (ATL-HPA018807) Datasheet (External Link) |
| Vendor Page | Anti NLE1 pAb (ATL-HPA018807) |