Anti NIT2 pAb (ATL-HPA036999)

Atlas Antibodies

Catalog No.: ATL-HPA036999-25

Protein Description: nitrilase family, member 2
Gene Name: NIT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022751: 94%, ENSRNOG00000027797: 94%
Entrez Gene ID: 56954
Uniprot ID: Q9NQR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYAQ
• Gene Sequence: YLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYAQ
• Gene ID - Mouse: ENSMUSG00000022751
• Gene ID - Rat: ENSRNOG00000027797
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.