Anti NIPBL pAb (ATL-HPA040834)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040834-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NIPBL
Alternative Gene Name: DKFZp434L1319, FLJ11203, FLJ12597, FLJ13354, FLJ13648, IDN3, Scc2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022141: 99%, ENSRNOG00000056907: 100%
Entrez Gene ID: 25836
Uniprot ID: Q6KC79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSSKAKRAKCS |
| Gene Sequence | TEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSSKAKRAKCS |
| Gene ID - Mouse | ENSMUSG00000022141 |
| Gene ID - Rat | ENSRNOG00000056907 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NIPBL pAb (ATL-HPA040834) | |
| Datasheet | Anti NIPBL pAb (ATL-HPA040834) Datasheet (External Link) |
| Vendor Page | Anti NIPBL pAb (ATL-HPA040834) at Atlas Antibodies |
| Documents & Links for Anti NIPBL pAb (ATL-HPA040834) | |
| Datasheet | Anti NIPBL pAb (ATL-HPA040834) Datasheet (External Link) |
| Vendor Page | Anti NIPBL pAb (ATL-HPA040834) |
| Citations for Anti NIPBL pAb (ATL-HPA040834) – 1 Found |
| Xu, Weizhen; Ying, Yinyin; Shan, Lihong; Feng, Jianguo; Zhang, Shengjie; Gao, Yun; Xu, Xiaoling; Yao, Yinli; Zhu, Chihong; Mao, Weimin. Enhanced expression of cohesin loading factor NIPBL confers poor prognosis and chemotherapy resistance in non-small cell lung cancer. Journal Of Translational Medicine. 2015;13( 25963978):153. PubMed |