Anti NIPBL pAb (ATL-HPA040834)

Atlas Antibodies

Catalog No.:
ATL-HPA040834-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Nipped-B homolog (Drosophila)
Gene Name: NIPBL
Alternative Gene Name: DKFZp434L1319, FLJ11203, FLJ12597, FLJ13354, FLJ13648, IDN3, Scc2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022141: 99%, ENSRNOG00000056907: 100%
Entrez Gene ID: 25836
Uniprot ID: Q6KC79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSSKAKRAKCS
Gene Sequence TEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSSKAKRAKCS
Gene ID - Mouse ENSMUSG00000022141
Gene ID - Rat ENSRNOG00000056907
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NIPBL pAb (ATL-HPA040834)
Datasheet Anti NIPBL pAb (ATL-HPA040834) Datasheet (External Link)
Vendor Page Anti NIPBL pAb (ATL-HPA040834) at Atlas Antibodies

Documents & Links for Anti NIPBL pAb (ATL-HPA040834)
Datasheet Anti NIPBL pAb (ATL-HPA040834) Datasheet (External Link)
Vendor Page Anti NIPBL pAb (ATL-HPA040834)
Citations for Anti NIPBL pAb (ATL-HPA040834) – 1 Found
Xu, Weizhen; Ying, Yinyin; Shan, Lihong; Feng, Jianguo; Zhang, Shengjie; Gao, Yun; Xu, Xiaoling; Yao, Yinli; Zhu, Chihong; Mao, Weimin. Enhanced expression of cohesin loading factor NIPBL confers poor prognosis and chemotherapy resistance in non-small cell lung cancer. Journal Of Translational Medicine. 2015;13( 25963978):153.  PubMed