Anti NIPAL4 pAb (ATL-HPA038259)

Atlas Antibodies

Catalog No.:
ATL-HPA038259-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NIPA-like domain containing 4
Gene Name: NIPAL4
Alternative Gene Name: ICHYN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020411: 78%, ENSRNOG00000006255: 82%
Entrez Gene ID: 348938
Uniprot ID: Q0D2K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKDLDISCASLPHMHKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS
Gene Sequence FKDLDISCASLPHMHKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS
Gene ID - Mouse ENSMUSG00000020411
Gene ID - Rat ENSRNOG00000006255
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NIPAL4 pAb (ATL-HPA038259)
Datasheet Anti NIPAL4 pAb (ATL-HPA038259) Datasheet (External Link)
Vendor Page Anti NIPAL4 pAb (ATL-HPA038259) at Atlas Antibodies

Documents & Links for Anti NIPAL4 pAb (ATL-HPA038259)
Datasheet Anti NIPAL4 pAb (ATL-HPA038259) Datasheet (External Link)
Vendor Page Anti NIPAL4 pAb (ATL-HPA038259)