Anti NIPAL1 pAb (ATL-HPA036765)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036765-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NIPAL1
Alternative Gene Name: DKFZp686A06115, NPAL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067219: 73%, ENSRNOG00000025882: 69%
Entrez Gene ID: 152519
Uniprot ID: Q6NVV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NTDITWSELTSTAKKEAVSLNVNENNYVLLENLECSAPGYNDDVTLFSRTDD |
| Gene Sequence | NTDITWSELTSTAKKEAVSLNVNENNYVLLENLECSAPGYNDDVTLFSRTDD |
| Gene ID - Mouse | ENSMUSG00000067219 |
| Gene ID - Rat | ENSRNOG00000025882 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NIPAL1 pAb (ATL-HPA036765) | |
| Datasheet | Anti NIPAL1 pAb (ATL-HPA036765) Datasheet (External Link) |
| Vendor Page | Anti NIPAL1 pAb (ATL-HPA036765) at Atlas Antibodies |
| Documents & Links for Anti NIPAL1 pAb (ATL-HPA036765) | |
| Datasheet | Anti NIPAL1 pAb (ATL-HPA036765) Datasheet (External Link) |
| Vendor Page | Anti NIPAL1 pAb (ATL-HPA036765) |