Anti NIPAL1 pAb (ATL-HPA036765)

Atlas Antibodies

Catalog No.: ATL-HPA036765-25

Protein Description: NIPA-like domain containing 1
Gene Name: NIPAL1
Alternative Gene Name: DKFZp686A06115, NPAL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067219: 73%, ENSRNOG00000025882: 69%
Entrez Gene ID: 152519
Uniprot ID: Q6NVV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTDITWSELTSTAKKEAVSLNVNENNYVLLENLECSAPGYNDDVTLFSRTDD
• Gene Sequence: NTDITWSELTSTAKKEAVSLNVNENNYVLLENLECSAPGYNDDVTLFSRTDD
• Gene ID - Mouse: ENSMUSG00000067219
• Gene ID - Rat: ENSRNOG00000025882
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.