Anti NIFK pAb (ATL-HPA035736)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035736-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NIFK
Alternative Gene Name: hNIFK, MKI67IP, Nopp34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026377: 74%, ENSRNOG00000025701: 75%
Entrez Gene ID: 84365
Uniprot ID: Q9BYG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLA |
| Gene Sequence | AFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLA |
| Gene ID - Mouse | ENSMUSG00000026377 |
| Gene ID - Rat | ENSRNOG00000025701 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NIFK pAb (ATL-HPA035736) | |
| Datasheet | Anti NIFK pAb (ATL-HPA035736) Datasheet (External Link) |
| Vendor Page | Anti NIFK pAb (ATL-HPA035736) at Atlas Antibodies |
| Documents & Links for Anti NIFK pAb (ATL-HPA035736) | |
| Datasheet | Anti NIFK pAb (ATL-HPA035736) Datasheet (External Link) |
| Vendor Page | Anti NIFK pAb (ATL-HPA035736) |