Anti NIFK pAb (ATL-HPA035736)

Atlas Antibodies

Catalog No.:
ATL-HPA035736-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nucleolar protein interacting with the FHA domain of MKI67
Gene Name: NIFK
Alternative Gene Name: hNIFK, MKI67IP, Nopp34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026377: 74%, ENSRNOG00000025701: 75%
Entrez Gene ID: 84365
Uniprot ID: Q9BYG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLA
Gene Sequence AFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLA
Gene ID - Mouse ENSMUSG00000026377
Gene ID - Rat ENSRNOG00000025701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NIFK pAb (ATL-HPA035736)
Datasheet Anti NIFK pAb (ATL-HPA035736) Datasheet (External Link)
Vendor Page Anti NIFK pAb (ATL-HPA035736) at Atlas Antibodies

Documents & Links for Anti NIFK pAb (ATL-HPA035736)
Datasheet Anti NIFK pAb (ATL-HPA035736) Datasheet (External Link)
Vendor Page Anti NIFK pAb (ATL-HPA035736)