Anti NHLRC2 pAb (ATL-HPA038493)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038493-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NHLRC2
Alternative Gene Name: DKFZp779F115, FLJ20147, FLJ25621, FLJ33312, MGC45492
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025078: 93%, ENSRNOG00000016948: 93%
Entrez Gene ID: 374354
Uniprot ID: Q8NBF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SAVLRYNITHPMVNDADASLWQELEVSCWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIRDNKIGIKLYKDSLPPSPLLFPG |
| Gene Sequence | SAVLRYNITHPMVNDADASLWQELEVSCWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIRDNKIGIKLYKDSLPPSPLLFPG |
| Gene ID - Mouse | ENSMUSG00000025078 |
| Gene ID - Rat | ENSRNOG00000016948 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NHLRC2 pAb (ATL-HPA038493) | |
| Datasheet | Anti NHLRC2 pAb (ATL-HPA038493) Datasheet (External Link) |
| Vendor Page | Anti NHLRC2 pAb (ATL-HPA038493) at Atlas Antibodies |
| Documents & Links for Anti NHLRC2 pAb (ATL-HPA038493) | |
| Datasheet | Anti NHLRC2 pAb (ATL-HPA038493) Datasheet (External Link) |
| Vendor Page | Anti NHLRC2 pAb (ATL-HPA038493) |