Anti NFAM1 pAb (ATL-HPA031812)

Atlas Antibodies

Catalog No.: ATL-HPA031812-25

Protein Description: NFAT activating protein with ITAM motif 1
Gene Name: NFAM1
Alternative Gene Name: CNAIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058099: 51%, ENSRNOG00000022975: 52%
Entrez Gene ID: 150372
Uniprot ID: Q8NET5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYE
• Gene Sequence: NKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYE
• Gene ID - Mouse: ENSMUSG00000058099
• Gene ID - Rat: ENSRNOG00000022975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NFAM1 pAb (ATL-HPA031812) – 1 Found

Juchem, Kathryn W; Gounder, Anshu P; Gao, Jian Ping; Seccareccia, Elise; Yeddula, Narayana; Huffmaster, Nicholas J; Côté-Martin, Alexandra; Fogal, Steven E; Souza, Donald; Wang, Sarah Sirui; Glynn, Elizabeth R A; Yung, Ivy; Ritchie, Julie; Li, Li; Zheng, Jie; Mbow, M Lamine; Li, Jun; Chanda, Sumit K. NFAM1 Promotes Pro-Inflammatory Cytokine Production in Mouse and Human Monocytes. Frontiers In Immunology. 12( 35095847):773445.