Anti NEURL1B pAb (ATL-HPA037612)

Atlas Antibodies

Catalog No.: ATL-HPA037612-25

Protein Description: neuralized E3 ubiquitin protein ligase 1B
Gene Name: NEURL1B
Alternative Gene Name: DKFZP761M1511, Neur2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034413: 91%, ENSRNOG00000027606: 91%
Entrez Gene ID: 54492
Uniprot ID: A8MQ27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALIDVYGITDEVQLLESAFADTLTPARLSQARFSACLPPSSHDAANFDNNELENNQVVAKLGHL
• Gene Sequence: ALIDVYGITDEVQLLESAFADTLTPARLSQARFSACLPPSSHDAANFDNNELENNQVVAKLGHL
• Gene ID - Mouse: ENSMUSG00000034413
• Gene ID - Rat: ENSRNOG00000027606
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.