Anti NEU3 pAb (ATL-HPA038729)

Atlas Antibodies

Catalog No.:
ATL-HPA038729-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sialidase 3 (membrane sialidase)
Gene Name: NEU3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035239: 57%, ENSRNOG00000018106: 57%
Entrez Gene ID: 10825
Uniprot ID: Q9UQ49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFK
Gene Sequence PLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFK
Gene ID - Mouse ENSMUSG00000035239
Gene ID - Rat ENSRNOG00000018106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEU3 pAb (ATL-HPA038729)
Datasheet Anti NEU3 pAb (ATL-HPA038729) Datasheet (External Link)
Vendor Page Anti NEU3 pAb (ATL-HPA038729) at Atlas Antibodies

Documents & Links for Anti NEU3 pAb (ATL-HPA038729)
Datasheet Anti NEU3 pAb (ATL-HPA038729) Datasheet (External Link)
Vendor Page Anti NEU3 pAb (ATL-HPA038729)