Anti NEDD4L pAb (ATL-HPA024618)

Atlas Antibodies

Catalog No.: ATL-HPA024618-25

Protein Description: neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
Gene Name: NEDD4L
Alternative Gene Name: KIAA0439, NEDD4-2, RSP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024589: 97%, ENSRNOG00000017610: 97%
Entrez Gene ID: 23327
Uniprot ID: Q96PU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEM
• Gene Sequence: SATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEM
• Gene ID - Mouse: ENSMUSG00000024589
• Gene ID - Rat: ENSRNOG00000017610
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NEDD4L pAb (ATL-HPA024618) – 2 Found

Guo, Jianping; Cheng, Ji; Zheng, Nana; Zhang, Xiaomei; Dai, Xiaoming; Zhang, Linli; Hu, Changjiang; Wu, Xueji; Jiang, Qiwei; Wu, Depei; Okada, Hitoshi; Pandolfi, Pier Paolo; Wei, Wenyi. Copper Promotes Tumorigenesis by Activating the PDK1-AKT Oncogenic Pathway in a Copper Transporter 1 Dependent Manner. Advanced Science (Weinheim, Baden-Wurttemberg, Germany). 2021;8(18):e2004303. 

Dong, Huiyue; Zhu, Ling; Sun, Jingjing; Zhang, Yi; Cui, Qiang; Wu, Lin; Chen, Shushang; Lu, Jun. Pan-cancer Analysis of NEDD4L and Its Tumor Suppressor Effects in Clear Cell Renal Cell Carcinoma. Journal Of Cancer. 12(20):6242-6253.