Anti NEDD1 pAb (ATL-HPA038591 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038591-25

Protein Description: neural precursor cell expressed, developmentally down-regulated 1
Gene Name: NEDD1
Alternative Gene Name: GCP-WD, TUBGCP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019988: 88%, ENSRNOG00000004011: 89%
Entrez Gene ID: 121441
Uniprot ID: Q8NHV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSTPNPKIASSVTAGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGL
• Gene Sequence: SSTPNPKIASSVTAGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGL
• Gene ID - Mouse: ENSMUSG00000019988
• Gene ID - Rat: ENSRNOG00000004011
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NEDD1 pAb (ATL-HPA038591 w/enhanced validation) – 1 Found

Huang, Fan; Xu, Xiaowei; Xin, Guangwei; Zhang, Boyan; Jiang, Qing; Zhang, Chuanmao. Cartwheel disassembly regulated by CDK1-cyclin B kinase allows human centriole disengagement and licensing. The Journal Of Biological Chemistry. 2022;298(12):102658.