Anti NECTIN4 pAb (ATL-HPA010775 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA010775-25

Protein Description: nectin cell adhesion molecule 4
Gene Name: NECTIN4
Alternative Gene Name: LNIR, nectin-4, PRR4, PVRL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006411: 90%, ENSRNOG00000004029: 90%
Entrez Gene ID: 81607
Uniprot ID: Q96NY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL
• Gene Sequence: KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL
• Gene ID - Mouse: ENSMUSG00000006411
• Gene ID - Rat: ENSRNOG00000004029
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NECTIN4 pAb (ATL-HPA010775 w/enhanced validation) – 7 Found

Geekiyanage, Hirosha; Galanis, Evanthia. MiR-31 and miR-128 regulates poliovirus receptor-related 4 mediated measles virus infectivity in tumors. Molecular Oncology. 2016;10(9):1387-1403. 

Richardson, Rose; Mitchell, Karen; Hammond, Nigel L; Mollo, Maria Rosaria; Kouwenhoven, Evelyn N; Wyatt, Niki D; Donaldson, Ian J; Zeef, Leo; Burgis, Tim; Blance, Rognvald; van Heeringen, Simon J; Stunnenberg, Hendrik G; Zhou, Huiqing; Missero, Caterina; Romano, Rose Anne; Sinha, Satrajit; Dixon, Michael J; Dixon, Jill. p63 exerts spatio-temporal control of palatal epithelial cell fate to prevent cleft palate. Plos Genetics. 2017;13(6):e1006828. 

Allen, Ingrid V; McQuaid, Stephen; Penalva, Rosana; Ludlow, Martin; Duprex, W Paul; Rima, Bertus K. Macrophages and Dendritic Cells Are the Predominant Cells Infected in Measles in Humans. Msphere. 2018;3(3) 

Lough, Kendall J; Spitzer, Danielle C; Bergman, Abby J; Wu, Jessica J; Byrd, Kevin M; Williams, Scott E. Disruption of the nectin-afadin complex recapitulates features of the human cleft lip/palate syndrome CLPED1. Development (Cambridge, England). 2020;147(21) 

Razzaghdoust, Abolfazl; Muhammadnejad, Samad; Parvin, Mahmoud; Mofid, Bahram; Zangeneh, Masoumeh; Basiri, Abbas. Development and immunohistochemical characterization of patient-derived xenograft models for muscle invasive bladder cancer. Iranian Journal Of Basic Medical Sciences. 2021;24(12):1650-1655. 

Razzaghdoust, Abolfazl; Rahmatizadeh, Shahabedin; Mofid, Bahram; Muhammadnejad, Samad; Parvin, Mahmoud; Torbati, Peyman Mohammadi; Basiri, Abbas. Data-Driven Discovery of Molecular Targets for Antibody-Drug Conjugates in Cancer Treatment. Biomed Research International. 2021( 33490264):2670573. 

Rodler, Severin; Eismann, Lennert; Schlenker, Boris; Casuscelli, Jozefina; Brinkmann, Isabel; Sendelhofert, Andrea; Waidelich, Raphaela; Buchner, Alexander; Stief, Christian; Schulz, Gerald Bastian; Ledderose, Stephan. Expression of Nectin-4 in Variant Histologies of Bladder Cancer and Its Prognostic Value-Need for Biomarker Testing in High-Risk Patients?. Cancers. 2022;14(18)