Anti NECTIN2 pAb (ATL-HPA012759 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012759-25

Protein Description: nectin cell adhesion molecule 2
Gene Name: NECTIN2
Alternative Gene Name: CD112, HVEB, PRR2, PVRL2, PVRR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062300: 63%, ENSRNOG00000018730: 64%
Entrez Gene ID: 5819
Uniprot ID: Q92692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR
• Gene Sequence: VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR
• Gene ID - Mouse: ENSMUSG00000062300
• Gene ID - Rat: ENSRNOG00000018730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NECTIN2 pAb (ATL-HPA012759 w/enhanced validation) – 1 Found

Ho, Daniel Wai-Hung; Tsui, Yu-Man; Chan, Lo-Kong; Sze, Karen Man-Fong; Zhang, Xin; Cheu, Jacinth Wing-Sum; Chiu, Yung-Tuen; Lee, Joyce Man-Fong; Chan, Albert Chi-Yan; Cheung, Elaine Tin-Yan; Yau, Derek Tsz-Wai; Chia, Nam-Hung; Lo, Irene Lai-Oi; Sham, Pak-Chung; Cheung, Tan-To; Wong, Carmen Chak-Lui; Ng, Irene Oi-Lin. Single-cell RNA sequencing shows the immunosuppressive landscape and tumor heterogeneity of HBV-associated hepatocellular carcinoma. Nature Communications. 2021;12(1):3684.