Anti NECTIN1 pAb (ATL-HPA026846)

Atlas Antibodies

Catalog No.: ATL-HPA026846-25

Protein Description: nectin cell adhesion molecule 1
Gene Name: NECTIN1
Alternative Gene Name: CD111, CLPED1, ED4, HIgR, HVEC, OFC7, PRR, PRR1, PVRL1, PVRR1, SK-12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032012: 91%, ENSRNOG00000006403: 90%
Entrez Gene ID: 5818
Uniprot ID: Q15223
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
• Gene Sequence: DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
• Gene ID - Mouse: ENSMUSG00000032012
• Gene ID - Rat: ENSRNOG00000006403
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NECTIN1 pAb (ATL-HPA026846) – 1 Found

Ablain, Julien; Al Mahi, Amira; Rothschild, Harriet; Prasad, Meera; Aires, Sophie; Yang, Song; Dokukin, Maxim E; Xu, Shuyun; Dang, Michelle; Sokolov, Igor; Lian, Christine G; Zon, Leonard I. Loss of NECTIN1 triggers melanoma dissemination upon local IGF1 depletion. Nature Genetics. 2022;54(12):1839-1852.