Anti NECAP2 pAb (ATL-HPA028077)

Atlas Antibodies

Catalog No.: ATL-HPA028077-100

Protein Description: NECAP endocytosis associated 2
Gene Name: NECAP2
Alternative Gene Name: FLJ10420
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028923: 78%, ENSRNOG00000008427: 76%
Entrez Gene ID: 55707
Uniprot ID: Q9NVZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQ
• Gene Sequence: ANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQ
• Gene ID - Mouse: ENSMUSG00000028923
• Gene ID - Rat: ENSRNOG00000008427
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NECAP2 pAb (ATL-HPA028077) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.