Anti NDUFS5 pAb (ATL-HPA042582)

Atlas Antibodies

Catalog No.: ATL-HPA042582-25

Protein Description: NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase)
Gene Name: NDUFS5
Alternative Gene Name: CI-15k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028648: 77%, ENSRNOG00000029339: 75%
Entrez Gene ID: 4725
Uniprot ID: O43920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGK
• Gene Sequence: KECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGK
• Gene ID - Mouse: ENSMUSG00000028648
• Gene ID - Rat: ENSRNOG00000029339
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.