Anti NDUFS5 pAb (ATL-HPA042582)

Atlas Antibodies

Catalog No.:
ATL-HPA042582-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase)
Gene Name: NDUFS5
Alternative Gene Name: CI-15k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028648: 77%, ENSRNOG00000029339: 75%
Entrez Gene ID: 4725
Uniprot ID: O43920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGK
Gene Sequence KECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGK
Gene ID - Mouse ENSMUSG00000028648
Gene ID - Rat ENSRNOG00000029339
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFS5 pAb (ATL-HPA042582)
Datasheet Anti NDUFS5 pAb (ATL-HPA042582) Datasheet (External Link)
Vendor Page Anti NDUFS5 pAb (ATL-HPA042582) at Atlas Antibodies

Documents & Links for Anti NDUFS5 pAb (ATL-HPA042582)
Datasheet Anti NDUFS5 pAb (ATL-HPA042582) Datasheet (External Link)
Vendor Page Anti NDUFS5 pAb (ATL-HPA042582)