Anti NDUFB9 pAb (ATL-HPA042768)

Atlas Antibodies

Catalog No.: ATL-HPA042768-100

Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa
Gene Name: NDUFB9
Alternative Gene Name: B22, LYRM3, UQOR22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022354: 89%, ENSRNOG00000009364: 87%
Entrez Gene ID: 4715
Uniprot ID: Q9Y6M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
• Gene Sequence: FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
• Gene ID - Mouse: ENSMUSG00000022354
• Gene ID - Rat: ENSRNOG00000009364
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.