Anti NDUFB9 pAb (ATL-HPA042768)

Atlas Antibodies

Catalog No.:
ATL-HPA042768-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa
Gene Name: NDUFB9
Alternative Gene Name: B22, LYRM3, UQOR22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022354: 89%, ENSRNOG00000009364: 87%
Entrez Gene ID: 4715
Uniprot ID: Q9Y6M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
Gene Sequence FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
Gene ID - Mouse ENSMUSG00000022354
Gene ID - Rat ENSRNOG00000009364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFB9 pAb (ATL-HPA042768)
Datasheet Anti NDUFB9 pAb (ATL-HPA042768) Datasheet (External Link)
Vendor Page Anti NDUFB9 pAb (ATL-HPA042768) at Atlas Antibodies

Documents & Links for Anti NDUFB9 pAb (ATL-HPA042768)
Datasheet Anti NDUFB9 pAb (ATL-HPA042768) Datasheet (External Link)
Vendor Page Anti NDUFB9 pAb (ATL-HPA042768)