Anti NDUFB6 pAb (ATL-HPA044001)

Atlas Antibodies

Catalog No.: ATL-HPA044001-25

Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
Gene Name: NDUFB6
Alternative Gene Name: B17, CI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071014: 80%, ENSRNOG00000024539: 83%
Entrez Gene ID: 4712
Uniprot ID: O95139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNK
• Gene Sequence: LRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNK
• Gene ID - Mouse: ENSMUSG00000071014
• Gene ID - Rat: ENSRNOG00000024539
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NDUFB6 pAb (ATL-HPA044001) – 1 Found

Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56.